PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004490761.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family M-type_MADS
Protein Properties Length: 166aa    MW: 19585.1 Da    PI: 10.3801
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004490761.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF34.52.6e-111051243
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                    +i  ++ r+  + kR +g +KK +EL +LC+++++ i+f ++
  XP_004490761.1 10 FIAKDTARKAAYKKRIKGFMKKLNELTTLCGVRACAIVFKPD 51
                    788999********************************9887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.5E-14160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006613.428148IPR002100Transcription factor, MADS-box
CDDcd002665.99E-24285No hitNo description
SuperFamilySSF554553.27E-19294IPR002100Transcription factor, MADS-box
PfamPF003194.1E-131052IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MGGRKVKLAF IAKDTARKAA YKKRIKGFMK KLNELTTLCG VRACAIVFKP DEREPQIWPS  60
FQGVQNVLIR FMHIPDFERD RKMMNQETYL KERVLKVKEK LKKKTKDNRK TEMTVHMYNI  120
LETGIFPENF NTVDQNDLTY VIDEKIKEIQ MKMVELDNVQ AAVQRL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11631RKAAYKKRIKGFMKKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004490761.11e-120PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLG7K0T48e-73G7K0T4_MEDTR; MADS-box transcription factor family protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45233154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.14e-29AGAMOUS-like 80